PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG386800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bZIP
Protein Properties Length: 200aa    MW: 20864.4 Da    PI: 8.2114
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG386800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1582.1e-18128182357
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                          +++r +r++kNRe+A rsR+RK+a++ eLe++v+ L++eN++L+ + e+l+  v+
  Pavir.2KG386800.1.p 128 SDRRKKRMIKNRESAARSRARKQAYVRELEQEVQLLQQENESLRVKYEQLRASVE 182
                          689******************************************9999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.8E-15126190IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-16128182No hitNo description
PROSITE profilePS5021712.231128182IPR004827Basic-leucine zipper domain
PfamPF001706.2E-16129181IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.44E-13130182No hitNo description
CDDcd147071.17E-20130180No hitNo description
PROSITE patternPS000360133148IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MAAAMDMEDD EDIWGDAASS PSAVPPQPLA AAAASPCGAF ISTQLSLSSR LHLLSTAGGS  60
SAGIYAADGG RRHMDLGAGF RNAAASPAPF FSAYNPDAGA ARSALEDEMC LGPGAAAAAW  120
AGAGAGGSDR RKKRMIKNRE SAARSRARKQ AYVRELEQEV QLLQQENESL RVKYEQLRAS  180
VEVAVPVKKT LQRMPSAPF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0937897e-74EF093789.1 Zea mays delayed flowering1 (DLF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957504.11e-100PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLK3ZWU51e-100K3ZWU5_SETIT; Uncharacterized protein
STRINGSi031077m1e-100(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17770.21e-14basic region/leucine zipper motif 27